SP-A2 |
SPADKTNIKTAWEKIGS |
PMSMLRLamide |
||
[short peptide from AAT; short piece of alpha-1-antitrypsin] SPAAT peptide (MFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK) is derived from the C-terminal end of alpha-1-antitrypsin and corresponds to alpha-1-antitrypsin(375-418) [SERPINA1(375-418)]. This peptide is found in human tissue bound to the extracellular matrix. Placental SPAAT inhibits chymotrypsin, human neutrophil elastase, and pancreatic elastase, but has no effect on trypsin. Unlike alpha-1-antitrypsin, SPAAT is a reversible, competitive inhibitors of chymotrypsin. Placental SPAAT also binds to cathepsin G. Niemann et al (1997) have reported that SPAAT is a competitive inhibitor of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |