SP-D |
SP domain |
KFRKTCAPMGYCSPKCRVMDLKYTSGDCKYSCCIPTAWKGK |
||
[Serine protease dependent cell apoptosis] This kind of cell death differs from cell death by apoptosis in that it does not require the activation of caspases (see also: CICD, caspase-independent cell death) but rather depends on serine proteases as critical effectors of the apoptotic process.
The observation that particular apoptotic events can be prevented by broad-range inhibitors of serine proteases such as TLCK, TPCK or AEBSF (Egger et al, 2003; Liu et al, 2004; Thorburn et al, 2003) together with the observation that inhibition of caspases by suitable inhibitors may fail to prevent cell death
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |