COPE Media Kit


Cope Home
Previous entry:
US1.5
Next entry:
US27
Random entry:
YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
Search COPE:

US18

[Cytomegalovirus US18 protein] This protein is encoded in the genome of human cytomegalovirus. US18 is dispensable for HCMV replication in vitro in human fibroblasts but appears to be required for growth in the oral mucosa (Hai et al, 2006). Fielding et al (2014) have reported that US18 promotes the degradation by lysosomal degradation of MICA [MHC class I chain related molecule A], a ligand for NKG2D, a C-type lectin-like homodimer expressed on NK-cells and cytotoxic T-cells, that transmits activating signals (NK-cells) or co-stimulatory signals (CD8(+) Alpha-Beta T-cells and Gamma-Delta T-cells). It therefore acts as an immunoevasin that protects infected ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2015



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=52429