US1.5 |
US27 |
YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF |
||
[Cytomegalovirus US18 protein] This protein is encoded in the genome of human cytomegalovirus. US18 is dispensable for HCMV replication in vitro in human fibroblasts but appears to be required for growth in the oral mucosa (Hai et al, 2006). Fielding et al (2014) have reported that US18 promotes the degradation by lysosomal degradation of MICA [MHC class I chain related molecule A], a ligand for NKG2D, a C-type lectin-like homodimer expressed on NK-cells and cytotoxic T-cells, that transmits activating signals (NK-cells) or co-stimulatory signals (CD8(+) Alpha-Beta T-cells and Gamma-Delta T-cells). It therefore acts as an immunoevasin that protects infected
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |