VrCRP |
VRF |
Hepatitis C virus nonstructural protein 3 |
||
[Vigna radiata defensin 1; mungbean defensin 1] (RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC) This is the new name for a plant defensin identified originally by Chen et al (2002) who cloned the cDNA from bruchid-resistant mungbean and referred to the protein as VrCRP [Vigna radiate cysteine-rich protein]. VrCRP
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |