eNK-cells |
Enkephalin A |
SEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG |
||
Enkelytin (FAEPLPSEEEGESYSKEVPEMEKRYGGFM) is an antibacterial peptide produced by, and released from, adrenal medullary chromaffin granules of chromaffin cells (Goumon et al, 1996, 2000). It corresponds to the C-terminal 209-237 sequence of the PENK gene product proenkephalin A PENK(209-237) [proenkephalin-A(209-237), proenkephalin-A-derived peptide (209-237), abbr. PEAP209-237], known also as peptide B. The endogenous bisphosphorylated peptide has been shown to be active on Micrococcus luteus, Bacillus megaterium, Staphylococcus aureus and other Gram-positive bacteria at micromolar
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |