gadd7 |
gadd45 |
VPSPGSSEDDLQEEEQLEQAIKEHLGQGSSQEMEKLAKVS |
||
[growth arrest and DNA damage induced gene-34] This hamster gene belongs to the family of GADD genes the expression of which is induced by various genotoxic and non-genotoxic stresses. gadd34 is the homolog of murine MyD116 (Fornace et al, 1989; Lord et al, 1990). The approved gene symbol is PPP1R15A [Protein phosphatase 1 regulatory subunit 15A].
Expression of human gadd34 has been found to be induced by ionizing radiation in certain cell lines and appears to be correlated with cell death by apoptosis following ionizing radiation (Hollander et al, 1997). The expression of gadd34 is repressed by Myc
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |