Ac1-26 |
AC141 |
VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK |
||
[AC133(+), AC133(-), AC133(dim), AC133(high), AC133(low)]
AC133 antigen is an antigenic marker identified originally in hematopoietic stem cells (Miraglia et al, 1997). AC133 is the name of a monoclonal IgG1 antibody identified in a hybridoma generated from mice inoculated with CD34(+) cells enriched from fetal liver, fetal and adult bone marrow, cord blood, peripheral blood. The antibody identifies the CD34(+) population of hematopoietic stem cells from a fetal liver preparation (Yin et al, 1997). AC133 is expressed also in retinoblastoma cell lines and adult retina. Another monoclonal antibody, termed AC141, generated from mice
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |