Adrenotensin(163-183) |
adropin(34-76) |
laminin-beta-1(929-933) |
||
abbr. sometimes ADR. The name adropin is derived from the Latin roots 'aduro' [to set fire to] and 'pinquis' [fats or oils].
This secreted protein (CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP) is encoded by open reading frame C9orf165 [chromosome 9 open reading frame 165]. The approved gene symbol for this hormone is ENHO [energy homeostasis associated]. Aydan et al (2013) have reported expression of adropin in the brain (vascular area, pia mater, neuroglial cell, and neurons), cerebellum (neuroglial cells, Purkinje cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |