androgen-regulated message 1 |
androtropin |
GPR109A |
||
Andropin, VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK, is a male-specific antibacterial peptide in Drosophila melanogaster encoded by the CG1361 gene. Gene expression is induced strongly in response to mating and is confined strictly to the ejaculatory duct of adult males (Samakovlis et al, 1991). The antifungal activity of this peptide is lower than that of some Drosophila melanogaster cecropins (Ekengren and Hultmark, 1999).
Pérez-Cordero et al (2011) have reported that Andropin is active against intracellular forms of the Leishmania parasite.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |