CAP6 |
CAP-18 |
Superficial neuromasts |
||
[cationic antibacterial polypeptide of 11 kDa] CAP11 (GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI) has been purified from guinea pig neutrophil granules. CAP11 is a disulfide bonded homodimeric protein that is a member of the family of antimicrobial proteins known as cathelicidins. The protein is expressed in bone marrow cells and neutrophils, but not in eosinophils, mononuclear cells, or macrophages. The analysis of bone marrow cells shows that CAP11 mRNA is expressed predominantly at later stages of neutrophil maturation (metamyelocyte stage).
For other proteins/peptides with functions in innate immunity
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |