caterpillar cells |
CATERPILLER family |
QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL |
||
an acronym derived from caspase recruitment domain (see: CARD), transcription enhancer, r(purine)-binding, pyrin, lots of leucine repeats. Mammalian proteins containing these sequence domains comprise an entire family of immunoregulatory proteins (see: CLR family; Ting and Williams, 2005) and some members have been associated with a number of inflammatory disorders.
Monarch-1, a member of this protein family, has been described independently as PYPAF7. For some other members of this family see also: PYPAF1, PYPAF4, PYPAF5, CARD4 (NOD1), CARD7 (
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |