CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD |
CLAN-A |
protein lysine methyltransferases |
||
[CARD LRR and NACHT domain-containing protein] This protein contains a CARD domain, a centrally located nucleotide-binding domain (NBD or NACHT) and C-terminal leucine-rich repeat domains (LRR). CLAN protein is identical with CARD12 and has been described independently as IPAF. The approved gene symbol for this protein is NLRC4 [NLR family, CARD domain containing 4].
Damiano et al (2001) have described four different isoforms of CLAN, termed CLAN-A (full-length protein, 1024 amino acids), CLAN-B /359 amino acids, lacking CARD domain and nucleotide-binding domain),
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |