cryptome |
cryptopatch cells |
CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK |
||
Cryptonin is an antimicrobial peptide of 24 amino acids (GLLNGLALRLGKRALKKIIKRLCR) isolated from the adult Korean blackish cicada, Cryptotympana dubia (Korean horse cicada) (Park et al, 2007). Cryptonin shows strong antibacterial and antifungal activities against several bacteria and fungi, including two antibiotic-resistant bacterial strains; methicilin-resistant Staphylococcus aureus and vancomycin-resistant Enterococci. Cryptonin kills microbial cells by binding bacterial cell surfaces and disrupting the cell permeability.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other proteins/peptides with functions in innate immunity
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |