CYGB |
CYH |
Ob-Rf |
||
Cygnin has been discovered in lysozyme preparations of the black swan (Cygnus atratus) (Simpson and Morgan, 1983). The sequence of Cygnin (QVRKYCPKVGYCSSKCSKADVWSLSSDCKFYCCLPPGWK) is identical with Duck BPS2, and both proteins have been grouped as members of a family of avian proteins related to Beta-Defensins, referred to as ovodefensins (Gong et al, 2010). It is not known whether the peptide plays a role in host defense as direct antibacterial activity has not been demonstrated.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |