Immune-induced Molecule 15 |
Immune-induced Molecule 17 |
APKWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG |
||
abbr. DIM-16. This antimicrobial peptide from Drosophila melanogaster has been identified as Attacin C. See: Attacins. See also: Drosophila immune-induced molecules.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |