p17 |
p18 |
FGF2(130-139) |
||
This peptide with the sequence GDQNLQGPMLQGDPGFQRCIDGNVRLVFLFRGKKKKKKG has been shown to bind to heat shock protein hsp60 accumulated in cells undergoing cell death by apoptosis. P17 peptide binding correlates with phosphatidylserine exposure and caspase-3 activation in apoptotic cells and appears to lable late stages of apoptosis in cells and allows imaging of such cells in vitro and in vivo (Yang S et al, 2016).
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |