Phosphatidylinositol transfer protein, membrane-associated 3 |
phosphatidylserine binding protein p68 |
KNECLWTDMLSNFGYPGYQSKHYACIRQKG |
||
abbr. PtdSer; often PS (1,2-diacyl-sn-glycero-3-phospho-L-serine) This acidic phospholipid is synthesized in mammalian cells by two distinct Phosphatidylserine synthases (Vance and Tasseva, 2013). Phosphatidylserine is an essential component of cellular membranes (Leventis and Grinstein, 2010) and acts as a precursor for the synthesis of other phospholipids.
Phosphatidylserine is a multifunctional phospholipd that, among other things, modulates the activity of a great number of proteins with signaling activities. Various binding proteins or receptors have been identified as endogenous ligands of Phosphatidylserine (see, for example: Annexin-1, Annexin-5, Apolipoprotein H. BAI-1 [
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |