PNAS4 |
pncRNAs |
OvHV-2 IL10 |
||
This anticancer peptide (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG) (Kanovsky M et al, 2001) contains a sequence from p53 corresponding to p53(12-26) (PPLSQETFSDLWKLL) (see also: cryptides), a region that binds to the p53-binding protein MDM2 [Double minute 2 protein], an E3 ubiquitin-protein ligase protein that targets p53 for ubiquitination and degradation (Haupt et al, 1997). The anticancer peptide also contains a C-terminal Penetratin sequence derived from the antennapedia leader sequence as carrier.
Thadi et al (2020) have reported that PNC-27 binds to HDM-2 [human double minute 2] (gene symbol: MDM2 [mouse double minute 2 homolog]), an E3
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |