RNF136 |
RNF146 |
PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS |
||
[RING finger protein 137] This designation refers to the presence of a RING finger domain. The protein is identical with TRIM68 [tripartite motif-containing protein 68]
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |