severe congenital neutropenia 2 |
SEWSDCSVTCGKGMRTRQR |
alpha-s2-casein(1-32) |
||
[semen-derived enhancer of viral infection] SEVI is a positively charged amyloid fibril found in human semen that is derived from a self-assembling proteolytic cleavage fragment of prostatic acid phosphatase (Taylor et al, 1990; Sharief and Li, 1992; approved gene symbol: ACPP), a nonspecific tyrosine phosphatase with lipid phosphatase activity that inactivates lysophosphatidic acid in seminal plasma (Tanaka et al, 2004). Chuang et al (2010) have reported that the enzyme dephosphorylates ErbB2 and regulates prostate cancer cell growth.
SEVI corresponds to PAP(248-286) [prostatic acid phosphatase(248-286); ACPP(248-286)] (GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |