COPE Media Kit


Cope Home
Previous entry:
severe congenital neutropenia 2
Next entry:
SEWSDCSVTCGKGMRTRQR
Random entry:
alpha-s2-casein(1-32)
Search COPE:

SEVI

[semen-derived enhancer of viral infection] SEVI is a positively charged amyloid fibril found in human semen that is derived from a self-assembling proteolytic cleavage fragment of prostatic acid phosphatase (Taylor et al, 1990; Sharief and Li, 1992; approved gene symbol: ACPP), a nonspecific tyrosine phosphatase with lipid phosphatase activity that inactivates lysophosphatidic acid in seminal plasma (Tanaka et al, 2004). Chuang et al (2010) have reported that the enzyme dephosphorylates ErbB2 and regulates prostate cancer cell growth.


SEVI corresponds to PAP(248-286) [prostatic acid phosphatase(248-286); ACPP(248-286)] (GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: July 2014



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=45994