erbB1 |
erbB2 interacting protein |
KSCCRSTTARNIYNGCRVPGTARPVCAKKSGCKIQEAKKCEPPYD |
||
this is the same as p185erbB2. The receptor is being referred to also as EGF receptor 2 [epidermal growth factor receptor 2]. This gene is related to erbB (see: erb) and is identical with the neu oncogene. Another designation is HER2. The previously used gene symbol, NGL [neuro/glioblastoma-derived], has been withdrawn. In the nomenclature of CD antigens the protein has been given the designation CD340.
For a secreted splice variant see also: Herstatin.
In the nomenclature of CD antigens the protein has been given the designation
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |