TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT |
TAMs |
Tumor autocrine motility factor |
||
[TAM receptor]
This abbreviation is used sometimes as a collective term referring to the three tyrosine kinase receptors
Tyro3 [tyrosine-protein kinase 3] (known also as sky, rse, brt, dtk, or tif),
axl (known also as UFO ark. tyro7 [tyrosine-protein kinase 7], JTK11, and
Mer (known also as MERTK [mer tyrosine kinase], eyk [East Lansing Tyrosine Kinase], nyk [NCAM-related tyrosine kinase],
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |