TADG-14 |
Taeniophygin-2 |
Bone morphogenetic protein-2-beta |
||
This peptide (KFRKTCAPMGYCSPKCRVMDLKYTSGDCKYSCCIPTAWKGK), encoded in the genome of zebra finches (Taeniopygia guttata), has been identified by Gong et al (2010) through sequence databank searches. The peptide, related to Beta-Defensins, has been grouped as a member of the ovodefensin family of proteins. It is not known whether the peptide plays a role in host defense as direct antibacterial activity has not been demonstrated.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |