COPE Media Kit


Cope Home
Previous entry:
UL16
Next entry:
UL20A
Random entry:
IIKVPLKKFKSMRDVMRHEGIKAPVVHPATKY
Search COPE:

UL18

[Cytomegalovirus UL18 protein] This protein is encoded by an open reading frame in the genome of human cytomegalovirus. The protein is a class 1 homolog that binds Beta-2-Microglobulin, a subunit of MHC class 1 but it is not directly involved in the disruption of class 1 molecule assembly (Browne et al, 1992). Maffei et al (2008) have shown that CMV regulates the surface expression of UL18 by means of two motifs present in the cytoplasmic tail. The two motifs impairing UL18 surface expression and responsible for cytoplasmic retention are identical in all 17 HCMV strains examined.

UL18 has been shown to bind to CD85 (LIR1) (Chapman et al, 1999), a MHC class 1 receptor related to natural killer inhibitory receptors and expressed in ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2009



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=52186