UL16 |
UL20A |
IIKVPLKKFKSMRDVMRHEGIKAPVVHPATKY |
||
[Cytomegalovirus UL18 protein] This protein is encoded by an open reading frame in the genome of human cytomegalovirus. The protein is a class 1 homolog that binds Beta-2-Microglobulin, a subunit of MHC class 1 but it is not directly involved in the disruption of class 1 molecule assembly (Browne et al, 1992). Maffei et al (2008) have shown that CMV regulates the surface expression of UL18 by means of two motifs present in the cytoplasmic tail. The two motifs impairing UL18 surface expression and responsible for cytoplasmic retention are identical in all 17 HCMV strains examined.
UL18 has been shown to bind to CD85 (LIR1) (Chapman et al, 1999), a MHC class 1 receptor related to natural killer inhibitory receptors and expressed in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |