VAD |
vader |
HA4 |
||
[Vigna angularis defensin 1; azuki bean defensin 1] VaD1 (RTCMKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC) is a plant defensin isolated from azuki bean Vigna angularis Kao Hsiung No. 6. Its amino acid sequence shows 78.3 % homology to VrD1 [Vigna radiata defensin 1; mungbean defensin 1] (Chen et al, 2005). VaD1 inhibits the growth of Fusarium oxysporum, Fusarium oxysporum f. sp. pisi, Staphylococcus epidermidis, and Salmonella typhimurium. VaD1 also inhibits bruchid larval development, but is less active than VrD1.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |