YSPLDFIGSRamide |
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY |
integrin-alpha-6 |
||
A stable pre-pro-B-cell line derived from AA4.1+ yolk sac cells from day 10 mouse embryos. Long-term maintenance and expansion in vitro of these cells depends on direct contact with S17 stromal cells, but does not require additional growth factors such as IL7.
YS-PPB-cells express AA4.1, CD43, B220, Sca-1, CD19, heat stable antigen, MHC class 1, IL7 receptor, and Fc-gamma receptor. They do not express cytoplasmic mu-chain, surface IgM (sIgM), or MHC class 2 molecules. The cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |