APPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEVRAA |
APPIF |
workshop cluster 6 |
||
Appicans are secreted and cell-associated chondroitin sulfate proteoglycans containing Alzheimer amyloid precursor (APP) as their core protein (see: beta-amyloid peptide). Pangalos et al (1995) have reported that the core protein of appicans derives from an APP mRNA lacking exon 15. Deletion of this exon creates a new consensus sequence for the attachment of a chondroitin sulfate chain in the resulting APP protein. Transfection of C6 glioma or 293 kidney fibroblast cells with APP cDNAs containing exon 15 produce no appican, while transfection with an
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |