Fertilin-beta |
Fe-S cluster assembly protein DRE2 homolog |
VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK |
||
fes (v-fes), identified originally in Gardner-Arnstein and Snyder-Theilen isolates of feline sarcoma virus (fesV), and fps, a transforming gene common to the Fujinami, PRC II, and UR 1 strains of avian sarcoma virus, correspond to a common cellular genetic locus, which has remained highly conserved throughout vertebrate evolution.
The human fes/fps gene extends over 11 kb and contains 17 introns. It maps to chromosome 15q26.1, distal to the breakpoint in chromosome 15 in the translocation commonly seen in acute promyelocytic leukemia, t(15;17) (q24;q22).
The fes/fps oncogene encodes a non-receptor tyrosine-specific protein kinase of 92 kDa, called also NCP92
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |