receptor gamma chains |
receptor interacting protein |
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYL |
||
abbr. RIF (a term with multiple meanings). This biochemically uncharacterized glycoprotein of approximately 44 kDa is produced by murine P388-D1 cells (derived from macrophages). Glycosylation is not required for the biological activity of this factor.
This receptor inducing factor functions as a costimulator of IL2 receptor expression in resting CD8(+) T-cells and activated via the CD3 T-cell receptor. The factor is a competence factor (see: cell activation) that bestows upon cells the ability to respond to IL2. See also: IL2 receptor inducing factor.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |