ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
ASE chemosensory neurons |
PENK(237-258) |
||
This human leukemia cell line was established from a patient with acute myeloid leukemia (Miyazaki et al, 1997). The cells display characteristics of late erythroid progenitor cells like normal BFU-E or CFU-E (see also: hematopoiesis). The cells are CD36(+), Glycophorin A(+), and CD71(+), benzidine and PAS staining, and CD41(-). They express the transcription factor GATA-1 and a low affinity erythropoietin (Epo) receptor.
AS-E2 cells are strictly dependent on Epo
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |