immunoregulatory NK-cells |
Immunoregulin TP 1 |
Herpes simplex virus type 2 UL39 protein |
||
this peptide with the sequence of GGVTGVTEFEPVDVSGEDYDSDEMDEDGRA has been purified from the salivary glands of the horsefly (Hybomitra atriperoides) (Yan et al, 2008). Immunoregulin HA can inhibit the secretion of pro-inflammatory cytokines such as IFNgamma and the monocyte chemoattractant chemokine CCL2, and promotes the secretion of IL10 induced by LPS in rat splenocytes (for peptides with the same activities isolated from other horsefly species see: immunoregulin TP 1, Tabimmunregulins). Chen R et al (2019) have reported that macrophages are the major targeting
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |