PIA |
PIAS-1 |
LSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAH |
||
[protein inhibitor of activated STAT] These proteins constitute a protein family implicated in the inhibition of cytokine signaling by STAT proteins, latent cytoplasmic transcription factors that become activated in response to stimulation by various cytokines. All PIAS proteins are able to coactivate steroid receptor-dependent transcription but to a differential degree, depending on the receptor, the promoter, and the cell type. Concentrations of PIAS proteins that modulate steroid receptor-dependent transcription influence only marginally transactivation mediated by various STAT proteins. It is not known yet whether PIAS proteins play a more significant physiological role in steroid receptor than in cytokine
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |