SFFV gp55 |
SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW |
CXCL3 |
||
[Shope fibroma growth factor]; abbr. also SGF [Shope growth factor]. This protein of 80 amino acids is encoded by a gene of Shope fibroma virus (Chang et al, 1987). The protein is expressed in infected cells at an early stage of viral replication. The factor, like VGF (vaccinia growth factor) and MGF (myxoma growth factor) belongs to the EGF protein family (see: EGF) and shares sequence similarity with EGF and TGF-alpha. SFGF can functionally replace MGF in the induction of myxomatosis in rabbits.
SFGF is a major virulence factor in viral infection with MRV (malignant
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |