susceptibility to colon cancer 1 |
Sushi1 |
DPFFKVPVNKLAAVSNFGYDLYRVRSSMSPTTNV |
||
[sushi domain containing 2] The gene for this protein has been cloned by Watson et al (2013). Normal human breast tissues show weak or no expression of SUSD2 in normal epithelial cells, but endothelial cells lining vessels stain positive for SUSD2. Pathologic breast lesions and lobular and ductal carcinomas express SUSD2. SUSD2 interacts with Galectin-1, which is expressed by carcinoma cells and promotes tumor immune evasion, angiogenesis, and metastasis, and is necessary for cell surface expression of Galectin-1. Patrick and Egland (2019) have reported that proteolytic cleavage of SUSD2 by an as yet unknown protease is required for surface presentation of Galectin-1 on breast cancer
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |