COPE Media Kit


Cope Home
Previous entry:
susceptibility to colon cancer 1
Next entry:
Sushi1
Random entry:
DPFFKVPVNKLAAVSNFGYDLYRVRSSMSPTTNV
Search COPE:

SUSD2

[sushi domain containing 2] The gene for this protein has been cloned by Watson et al (2013). Normal human breast tissues show weak or no expression of SUSD2 in normal epithelial cells, but endothelial cells lining vessels stain positive for SUSD2. Pathologic breast lesions and lobular and ductal carcinomas express SUSD2. SUSD2 interacts with Galectin-1, which is expressed by carcinoma cells and promotes tumor immune evasion, angiogenesis, and metastasis, and is necessary for cell surface expression of Galectin-1. Patrick and Egland (2019) have reported that proteolytic cleavage of SUSD2 by an as yet unknown protease is required for surface presentation of Galectin-1 on breast cancer ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: November 2019



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=48226