COPE Media Kit


Cope Home
Previous entry:
Hematopoietic progenitor cell growth stimulating activity
Next entry:
hematopoietic protein 1
Random entry:
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR
Search COPE:

hematopoietic progenitor cells

[hematopoietic progenitor cell]

abbr. HPCs. These cells are immature CD34(+) cells that differentiate from hematopoietic stem cells. They constitute a heterogeneous population both in size and immunological features (Bender et al, 1991; D'Arena et al, 1996, 1996; Fritsch et al, 1996; Steen et al, 1994; Tjønnfjord et al, 1996; To et al, 1994). These cells are multipotent but their developmental potential is more restricted than that of hematopoietic stem cells. Hematopoietic progenitor cells can be detected in vitro by their ability to form distinct colonies in colony formation assays (see: Wognum et al, 2013), where they are identified as Colony-forming cells or Colony-forming units (see: ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: July 2014



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=23421