SCYA2 |
SCYA3L1 |
AANFGPSVFTPEVHETWQKFLNVVVAALGKQYE |
||
[small inducible cytokine A3] This factor is identical with MIP-1-alpha (macrophage inflammatory protein). See: MIP. It has been described under the following gene names: 464.1, G0S-19-1, L2G25B, LD78, MIP-1-alpha, SCI, TY5. The approved gene symbol is CCL3.
See also: SCY family of cytokines. See also: Chemokines.
This factor is known mainly because of its chemotactic activity. For an unrelated function as an antimicrobial peptide in innate immunity see: CCL3
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |