Paraaortic splanchnopleura |
paracaspase-1 |
tumor protein p53 regulated apoptosis inducing protein 1 |
||
Parabutoporin (FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ) is a pore-forming peptide previously isolated from the venom of the South-African scorpion Parabuthus schlechteri. For a related peptide see also: Im-1. The peptide is active against Gram-negative bacteria (Moerman et al, 2002).
Moerman et al (2003) have reported that the peptide induce Ca(2+) signaling in HL-60 (promyelocytic leukemia) cells.
Parabutoporin has been shown to induce chemotaxis of neutrophils via a pertussis toxin-sensitive way and to reduce strongly the superoxide production by the NADPH oxidase complex after either PMA or fMLP
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |