proNGF |
Pro-oncosis receptor inducing membrane injury |
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR |
||
[pronormoblast]
Morphologically, these cells are the most immature cells of a series of developmental intermediates leading to the formation of erythrocytes. These cells are called also proerythroblasts or rubriblasts. See: erythropoiesis.
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture. For other entries pertaining to hematopoiesis see also the Hematology Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |