PSA |
PS-alpha |
IaI-associated SUPER determinants |
||
psacotheasin is a 34 amino acid knottin-type antimicrobial peptide (CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK) from the yellow-spotted long-horned beetle Psacothea hilaris (Hwang et al, 2010). Chemically synthesized psacotheasin shows potent activities against both Gram-positive bacteria and Gram-negative bacterial strains. Psacotheasin shows remarkable antifungal properties without hemolytic activity against human erythrocytes. It acts as a pore-forming peptide that depolarizes and perturbs the plasma membrane (Hwang et al, 2010).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |